Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649728
StrainM_smegmatis_JS623
Protein IDYP_007294730.1
Description putative esterase [Mycobacterium smegmatis JS623]
Sequence MRLLLGRICVVLLAVLATVAVESPTAAAYSRKGLPVESLDVPSPSMGRNI
KVQFQGGGPHSVLLLDGLRAQDDASGWDVNTAAFEWFYQSGVSVIMPVGG
QSSFYSDWYQPATGSSGTLTYKWETFLTQELPAWLAANKAQAPTGNAVVG
LSMSGSAALTLAIWHPTQFIFASSLSGYLNPSNGLWPTLIGVSMKDAGGY
NASNMWGPTTDPAWRRNDPMVNISTLVANNTALWIYCGNGVTSELDDGAN
FGNQYSAQFLENITLSTNKEFQQKYVAAGGHNAVFNFPTDGTHSWGYWGS
QLQAMKPDLVRIIGAPPPPPS
B cell epitope (IEDB)0
T cell epitope (IEDB)13
MHC binder (IEDB)23
Vaccine TargetNo