Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649798
StrainM_smegmatis_JS623
Protein IDYP_007294800.1
Description arabinose efflux permease family protein [Mycobacterium smegmatis J
Sequence MPWLLISSWMWHLTRWGGLFLGTYLVTHLGGQPIANQFVGVAMFAPMLLG
TYVSTRVDLDHRKLVLVTELVLLPISVLMAVLVGSGAVATWMVFPYELAY
GFGGMVNMTAQRALLFGIAGPLRSMRVLNTELAGMASAMMLGPLIGGVTI
AKFGLGVAFGVPAALLACSAPLLWLSTRHLPAQPRETATATTGRNAHWRL
MRTSRPLAVILLVTLICNLCYFAFTPLVPVIAKHLGAGPAMAGVIGATAG
IVQLVIAAALIVRPARHPIPTYTVGVVLCLFGLGILSYTPVLTVALLALG
LAGIGQALFGSTQATLPFTAVAPHERAAALGLITTTIGVALPTGMVILGV
TSSLLGAQLAMLLSAFVGLVALVATLLASRGAISVGGEGDSITPQPQLGE
RARLGVVILDDVLEPDEWSADVDTDELGGLLVSGDRADRGLAAADANPEL
ALEDQDHVGLVDVEVRRLVLAEGDVVDRQPQRQTVFHHEAFDHQHRPADG
QT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo