Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649812
StrainM_smegmatis_JS623
Protein IDYP_007294814.1
Description dolichyl-phosphate-mannose--protein O-mannosyl transferase [Mycobac
Sequence MTALADELVAKGRAVPVISPAPLVPVADFGPVDRLQGWAMTAVITALAAI
TRFLNLGSPTDAGTPIFDEKHYAPQAWQVLHNHGVEDNPGYGLVVHPPVG
KQLIAIGEAIFGYNGLGWRFSGAVCGIILVLLVARIGRRISRSTLVGGMA
GLLLIGDGVSFVASRTALLDGFLVVFVVAAFGALIVDRDQVRERMHVALL
EGRISETPWGPRLGVRWWRFGAGVLLGLACATKWSGLYFIVFFGLMTLAF
DINARRQYRVPRPWVGALRRDLGPSLYALVLIPFGVYLASYSPWFASETA
VNRHEVGNSIGPDSVLPIPDALRSLWHYTYAAYHFHSGLTNAAGNHHPWE
SKPWTWPMSLRPVLYAIDNQNVPGCGAQSCVKAVMLVGTPAMWFIAVPVL
GWALWRAFVKRDWRYGALLVGYGAGFLPWFGDIDRQMYFFYAATMAPFLV
LMIAMILGDILHKPNQNAERRTLGLIAVCCYIALVITNFAWMYPILTGLP
ISQATWNMQIWLPSWR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo