Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649843
StrainM_smegmatis_JS623
Protein IDYP_007294845.1
Description family 3 adenylate cyclase [Mycobacterium smegmatis JS623]
Sequence MDRIWQWAWDRYGARYPWAVWLITFAEMLSAYLVWSSVIVALEKSSRYVE
ATAATAVAVAVMALVVMLPGNQVFRIAQRWAAGLEVDRAGALDATYTWAR
AALARSLGFMPASAALLLIVVGAIAGASGVTLVQYGILGAATGFAATLVT
THAFFEAAVRPIRAALAGDQPIGDGLPRARPTFATWLNLSTLGSLFWFAA
MGVGLGIVLDRSGDVPPAVLAVAIATTLALILGVPITVGTVVAPSLRPIR
DLAAGTERVAAGDYTQRLPVVQDDDLGALSASFNRMQAGLAERQRLRAAF
GTYVDPALAARLLEQGDDVFTGERREVTVMFVDVRDFTPFAEANTAEDTV
ARLNALFEIVVPAVVDAGGHVNKFLGDGALAVFGAPHDLANHADAAVNAG
VLIQRLVAEQFGGDLRVGIGINTGVVIAGTIGGGSHLEFTLIGDTTNVAA
RVEQLTKTTGDVILLTEQTVDALASRPSGLADRGSHALKGKSTAVQVFGL
DPKGRVSI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo