Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649850
StrainM_smegmatis_JS623
Protein IDYP_007294852.1
Description acetyltransferase- ribosomal protein N-acetylase [Mycobacterium sme
Sequence MPVGPLRVAGGLVRLRPVRLRDASSWSRIRLADRAHLEPWEPVTEVNWEV
RHAVSSWPSVCSGLRSEARKGRMLPYVIEVDGEFTGQLTIGNVTHGALRS
AWIGYWVASSATGGGIATAALALGLDHCFGPVMLHRVEATVRPENAASRA
VLAKVGFREEGLLRRYLDVDGAWRDHLLVAITTEELNGSAAGALVREGHA
QWA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo