Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649851
StrainM_smegmatis_JS623
Protein IDYP_007294853.1
Description molybdenum cofactor synthesis domain protein [Mycobacterium smegmat
Sequence MRSVEEQQARVAAAAVAPRPVRVAIAEAQGLMCAEEVVTERPLPGFDQAA
IDGYAVRSVDVLGVGGDDDGDGSDSDDDAGREVSLPVMGSIEAGARTPSR
LQPRQAARVQTGAPMPTLADAVLPLRWTDGGESRVTVLRGVRSGAYVRRT
GDDVQPGDVAVRAGTIVGAAQVGLLAAVGRERVLVHPRPRLSVMCVGGEL
VDISRTPGNGQVYDVNSYALAAAGRDAGAEVTRVGIVDTDPKELREVVEG
QVNRAEVVVIAGAVGGAAAESVRSVLAQLGDMEVTRIAMHPGSVQGFGQL
GPEGVPVFLLPANPVSALVVFEVMVRPLIRLTLGKRQPMRRVVQARTLSP
ISSVAGRKGYLRGQLMRDQDTGEYLVQALGGAPGASSHLLATLAEANCLV
VVPTEAEQVRTGEIVDVAFLAQRG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo