Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649863
StrainM_smegmatis_JS623
Protein IDYP_007294865.1
Description trypsin-like serine protease with C-terminal PDZ domain [Mycobacter
Sequence MTNHPRYSPPPPPGHRPGGHEQHAAPGYPGAPRQYQQPTQQQPYDWRYAT
QQQFRPPYDPYRGAPQQPPGMPLPPVRQKRSRAGALTAGALAVAIVSAGI
GGGVALLTQPDRPSATSSATGLAPSVPAASLPAGSVEQVAAKVVPSVVKL
EVDLGKQSEEGSGIILSSDGLILTNNHVVAAAKDNPGGPPAPVPAGGAQT
KVTFADGRTMGFTVVGTDPSSDIAVVRAQGASGLTPITLGSSSNLRVGQD
VVAVGSPLGLEGTVTTGIISALNRPVAAGGDAQNQNTVLDAIQTDAAINP
GNSGGALVNMNGELVGVNSAIATLGGDAGPQAQSGSIGLGFAIPVDQAKR
IADELIQSGTASHASLGVQVGNDAGVDGAKIVEVTSGGAAAAAGLPSGVV
VTKVDDRVIGSADALVAAVRSKAPGDKVTLTYLDPSGKPQTVQVTLGKAQ
Q
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo