Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649941
StrainM_smegmatis_JS623
Protein IDYP_007294943.1
Description putative F420-dependent oxidoreductase- MSMEG_2516 family [Mycobact
Sequence MVKDFRFGVGLTAARSRGTLEDTARRAEDMGYDALHMADHLYTTAPFPML
TAVAMATERLHIGTFVLNAGFYRPALLARDVTSLRDLSGGRFELGLGTGY
NEVEFEQAELPYPSAGKRVDWLRHVTKHMNENVPDVPILIAGDGDRVLTL
AAQRAHIIGLQGGAPAAADHDPLANRVAFVRDRAGDRFDELELNISVTAM
PTDDSGMPDLTIPRRFLPDLSDEELLRAPSVLSGSIKDMADTIRGYRDTY
GVTYITVQQPHAEVFAKVIAELR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo