Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649978
StrainM_smegmatis_JS623
Protein IDYP_007294980.1
Description acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Mycobacterium
Sequence MRVDEVRAAEAYRSGLWVRATLADALRDAARRTPERTVLVDGDIRLDCQA
LHERASALAYSLMRRMPPGSVVSFMLPNWHEAAVIYLGATLAGMVVNPVL
PSLRDHELRFILSDADSRAIFIPAEFGNHDYVAMLDRVVSEMASPPEVVV
LRGDGERSLPLEKSPKDRAVRNVRGHTTYESLFTDGAAAGLPVLNPDAVR
MILYTSGTTGLPKGVLHTHNSIHALISQIGDRWLVDEGDVFLVASPIAHI
GGSIYAFECPLLLGTTAVLMQRWNPEAAVQLMLVERCTHMAGATPFLVGL
LTAAEQAETRLPDLKVFICGGASVPPSLIRDTTAYFERAAVSRVYGSTEV
PVTTVGALGDVEHAAETDGRAGIADIKLVEGEIRARGPQMLVGYLHPDDE
TDAFDDEGYFRTGDLGCWIDDDYLVVTGRAKDIIIRNGENISPKEIEDIL
IGHAGVAEIAVVGIPDERTGERACAVIVACDQPAAPELSDLREMLMREGV
AKFKVPEQVEIWDSLPKNDAGKVLKHQIRAKLTTGASEATGRAEVDVRCK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo