Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650045
StrainM_smegmatis_JS623
Protein IDYP_007295047.1
Description uncharacterized protein with SCP/PR1 domains [Mycobacterium smegmat
Sequence MGMEKATALLTACAAAITLSGSVPAAAPALADGGVGSLRTPIGGDEGAAV
LNQINATRAANGCGPVAPNPQLTASAARQANDMLANGVQGHTGSDGSSPA
QRVMDAGYVSYANLGEIVFWSTGPGAGTPAAAVAWWMNSPRHRAIVTDCG
FTDAGFSAVSNGDKFTAAGDFGKT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo