Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650047
StrainM_smegmatis_JS623
Protein IDYP_007295049.1
Description Protein of unknown function (DUF3071) [Mycobacterium smegmatis JS62
Sequence MRELKVVGLDIDGKRIICEAEGLGEKFLLRPDDRLRAAVRGDTVGSSPPQ
NDTEVQSVLRPKDIQAKIRAGASVEQVASAAGVDIDRVQRFANPVLLERS
RAAELATAAHPVLPDGPSVLTLLETVTSALVARGLDPESTNWDAWRNEDG
RWTVQMGWKAGLSDLVAHFRYTPGAHGGTVTAFDDAACELIDPDFARPLR
PLAPVAELAYDEPEPEPALPIEELAAPEPPPAPKPRARKGKPAVPAWEDV
LLGVRSSGQR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo