Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650087
StrainM_smegmatis_JS623
Protein IDYP_007295089.1
Description aspartate/tyrosine/aromatic aminotransferase [Mycobacterium smegmat
Sequence MTVRRLEPYAVTIFAEMSALAARIGAVNLGQGFPDEDGPPAMLKVAENAI
AEGVNQYPPGLGIAPLREAIAAQRKRHFGTEYDPDTEVLVTVGATEAVAS
AVLGLVEPGSEVLLIEPFYDSYSPVIAMAGCERRAVPLVQNGRGFKIDVD
GLRNAVTPKTKALIVNSPHNPTGMVASEGELKALARLAVDADLLVITDEV
YEHLVFDGHRHTPLANYPGMKNRTVTISSAAKMFNCTGWKIGWACGAADL
MAGVRAAKQYLSYVGGAPFQPAVAHALNTEEAWVAALRDSLQAKRDKLGS
ALAELGFEVHDSFGTYFLCADPRPLGYHDSTEFCAQLPERAGVAAIPMSA
FCDPGAEHADAWNHLVRFAFCKRDETLDEAIRRLGVLRRH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo