Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650098
StrainM_smegmatis_JS623
Protein IDYP_007295100.1
Description putative RND superfamily drug exporter [Mycobacterium smegmatis JS6
Sequence MDVLARWLARYAGWIVAVVSVLFVLFGLYSAHLNSRLSGGGWTVPGSEEA
RAEQAQDAGFIGRGSSSVALLVHDDRFSAPSAEFEDRVAGVIRQVTADPR
LQIRSQPDWRSLTGPQKDEALGRDARTTLTTLELGIDDDTAKRVLPEVER
GLSVFNEAGLRVHLVGQAASVGAVNEVGAAALSRIELILLPLVIAILLVL
YRSVAAALVSLAVSVTAIVIAMGVMTWVAGVAELTVAAQTIATMLGLGVT
VDYSLVMIRRFIDELRVLDRAAALANTMRTAGRTVAASGATVAAALTTLL
IVNLPLIRSMAVTAVIVVVVAVITCLIALPAVLYLLGSRATAWRVPWLPS
SRDPARRRWERVARTIMARPVAALAITSIALLGLAVPALGLQTGGADASA
LPKSSSVRQGNDLVEEQYGKNAVDPILVVIEAERPFSGTKDFARLEAMTT
SLGQLDHVVRVASPVPLLHTVMPADPFAAIEPTNFQLLPADSRTLINRFV
SADRNTIAVDVFSNEGAGDSNVATLLGEVRTVAKHTAAPGWHISVGGTAA
IVLSASQHISDASPIVIAIMLVTIYLLLVLALRSLLLPCKAIALNLLSVG
ASVGAVVLIFQHGFLAGTVGIESVGPIQNFVPILLVTVLFSLSTDYEVFL
LSRVRERYELTGDNTESVTYGLVETAPLISGAALLMVTIFAAFVAVPMVT
VQQTGLAAAIAIAIDATVVRLVMVPAAMRLMGRWNWWLPRWMTPYRGRHR
RGPSCAPSHFDEVGAQCVP
gene ID433650098
StrainM_smegmatis_JS623
Protein IDYP_007295100.1
Description putative RND superfamily drug exporter [Mycobacterium smegmatis JS6
Sequence MDVLARWLARYAGWIVAVVSVLFVLFGLYSAHLNSRLSGGGWTVPGSEEA
RAEQAQDAGFIGRGSSSVALLVHDDRFSAPSAEFEDRVAGVIRQVTADPR
LQIRSQPDWRSLTGPQKDEALGRDARTTLTTLELGIDDDTAKRVLPEVER
GLSVFNEAGLRVHLVGQAASVGAVNEVGAAALSRIELILLPLVIAILLVL
YRSVAAALVSLAVSVTAIVIAMGVMTWVAGVAELTVAAQTIATMLGLGVT
VDYSLVMIRRFIDELRVLDRAAALANTMRTAGRTVAASGATVAAALTTLL
IVNLPLIRSMAVTAVIVVVVAVITCLIALPAVLYLLGSRATAWRVPWLPS
SRDPARRRWERVARTIMARPVAALAITSIALLGLAVPALGLQTGGADASA
LPKSSSVRQGNDLVEEQYGKNAVDPILVVIEAERPFSGTKDFARLEAMTT
SLGQLDHVVRVASPVPLLHTVMPADPFAAIEPTNFQLLPADSRTLINRFV
SADRNTIAVDVFSNEGAGDSNVATLLGEVRTVAKHTAAPGWHISVGGTAA
IVLSASQHISDASPIVIAIMLVTIYLLLVLALRSLLLPCKAIALNLLSVG
ASVGAVVLIFQHGFLAGTVGIESVGPIQNFVPILLVTVLFSLSTDYEVFL
LSRVRERYELTGDNTESVTYGLVETAPLISGAALLMVTIFAAFVAVPMVT
VQQTGLAAAIAIAIDATVVRLVMVPAAMRLMGRWNWWLPRWMTPYRGRHR
RGPSCAPSHFDEVGAQCVP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo