Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650122
StrainM_smegmatis_JS623
Protein IDYP_007295124.1
Description cation diffusion facilitator family transporter [Mycobacterium smeg
Sequence MPKAGGESTLTVLVAFGANFAIAVAKTVAGVITGSASMAAEAAHSWADTG
NEIFLLIADRRSARRPDERHPLGYGREAYVWSLLAAVGLFVIGATVSVWR
GVDELLHGERGAEDYRVAYIVLAVAFALEGVSWLQAMRQLRREAKRFDRD
LLTHALLTSDPTVRAVFAEDSAALIGIVVAALGIAMHEVTGEVAWDATGS
ILIGLLLAGVAVLLIDRNRRFLTGEPGTPALYDAAHTQLEEMPEIAAVRY
LRLEFIGPKQLFIVASVDLVGDKAESSVARTLRRLEQELEKSAFVVEAVL
TVSEPDGAGSQDG
gene ID433650122
StrainM_smegmatis_JS623
Protein IDYP_007295124.1
Description cation diffusion facilitator family transporter [Mycobacterium smeg
Sequence MPKAGGESTLTVLVAFGANFAIAVAKTVAGVITGSASMAAEAAHSWADTG
NEIFLLIADRRSARRPDERHPLGYGREAYVWSLLAAVGLFVIGATVSVWR
GVDELLHGERGAEDYRVAYIVLAVAFALEGVSWLQAMRQLRREAKRFDRD
LLTHALLTSDPTVRAVFAEDSAALIGIVVAALGIAMHEVTGEVAWDATGS
ILIGLLLAGVAVLLIDRNRRFLTGEPGTPALYDAAHTQLEEMPEIAAVRY
LRLEFIGPKQLFIVASVDLVGDKAESSVARTLRRLEQELEKSAFVVEAVL
TVSEPDGAGSQDG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo