Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650146
StrainM_smegmatis_JS623
Protein IDYP_007295148.1
Description putative esterase of the alpha-beta hydrolase superfamily [Mycobact
Sequence MTCNAFVLGGGGVLGAAEAGMARALVEAGVRPDLVCGTSIGAINGGAIAV
DLTRAGVERLLSMAHARCYHCRDRRDECPRVGWNKPGRRSTHGLPATPTN
RTHEPDGPACLDGTVNYA
gene ID433650146
StrainM_smegmatis_JS623
Protein IDYP_007295148.1
Description putative esterase of the alpha-beta hydrolase superfamily [Mycobact
Sequence MTCNAFVLGGGGVLGAAEAGMARALVEAGVRPDLVCGTSIGAINGGAIAV
DLTRAGVERLLSMAHARCYHCRDRRDECPRVGWNKPGRRSTHGLPATPTN
RTHEPDGPACLDGTVNYA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo