Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650227
StrainM_smegmatis_JS623
Protein IDYP_007295229.1
Description putative Zn-dependent hydrolase of beta-lactamase fold protein [Myc
Sequence MQLTHFGHSCLLANFKGESGQDTTVLFDPGNFSHGFEGVTGLSAILITHQ
HPDHADTERLPALVDANPQAALYADPQTAEQLGGPWKAVHVGDEFNVGHV
TVRGVGGRHAVIHPEIPVIDNISYLVGDGSHAARLMHPGDALFTPGEPVD
VLATPAAAPWMKISEAVEYLRAVAPARAVPIHQAIIEPNARGIYYGRLSE
MTDTDFQVLSEEDGTEF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo