Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650249
StrainM_smegmatis_JS623
Protein IDYP_007295251.1
Description putative dihydrodipicolinate reductase-like protein [Mycobacterium
Sequence MLSNNPIRVFQVATGNVGSEMIKRYGAQSELELVGVHCYSPEKIGKDAGE
LAGIEPNGVVATGTVEEIIAAKPDVLTFHGVFPDESLYVGVLEAGINVVT
TADWITGWHRDTNHPHPSGKPVSQVLAEACEKGGSTFYGTGMNPGVNQIL
GVVCSADVAEIENVTTIESVDVSCHHSKDTWIEVGYGLPVDDPSTPAKLE
KYTRVFADSVLMMADCFDLKLDEVKFSYELGACTKDVDLGWYVLPKGSLG
GNYIKYQGMVDGVPRVETHLEWQMTPHTDPHWDIKGCYITQIKGDPCVYN
KHMIFPKPGVDLSDPSNFASIGMTVTGMPALHAIKSVVAAAPGLLTSADL
PLRGFAGRFRI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo