Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650295
StrainM_smegmatis_JS623
Protein IDYP_007295297.1
Description aerobic-type carbon monoxide dehydrogenase- large subunit CoxL/CutL
Sequence MTETVVARYAGARVPRVEDNRLLTGRGTFVDDVTRPGLLHACFVRSPFAR
AKLGGIDATAALALPGVRAVLTAADINRDVKEAWHAVAGKDIPDTPRPPL
AEGEVKFVGDPVALVIAESRYLAEDAVELVEVDYVPLPAIADFTRAFGGS
AAGVPVVHEAYPDNVAGGMGGAPPDEETFASAAHVAEANVYQQIYAPVPI
ETRGMVVEWEASSEELTVWASTQTPHELRAFAARLLGIPAQGVRVIMRDT
GGGFGQKVVPMREDMCILLAARKVPFALKWIEDRRENLMSAGQARHVDGK
ARMAFDEEGNILAADIDFVYDIGAYPTPYPVLTTAAVGMFFPGPYRVPKA
SFNYKTVFSNTAGLAAYRGPWQYETLTREILLDIAARKMNMDPVELRRRN
ILRGDEMPYFNPNGMPYDHVAPADTFEQAVKILDHEGFRREQREALEHGR
YLGLGFSAYIEPTGAATGHLATEGATIRMEPTGKINVYVNGGSTGNSIET
TVVQLTADALGAKIEDVSTIQGDTAVTPYGAGTQGSRSGPMTAGAVHEAG
GMLRKQIVAMAAHRLGVEEADIELSGSKALVREDPSKNVSFADIAYRSYY
EPQQLPPGMAATLEATARFTSQAMIHWANATHACTCEVDVETGHVTLTRY
IVSEDVGAMINPNVVEGQIAGGTVQGIGGALLENMVYDDDGNPLSSTFVD
YLLPTATEVPPIEYGHVEIPGPGIGGYKGVGEGGAIGSTPAVINAINDAL
APLSVTLTRLPASPAAIVELIEQATK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo