Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650324
StrainM_smegmatis_JS623
Protein IDYP_007295326.1
Description 2-nitropropane dioxygenase-like enzyme [Mycobacterium smegmatis JS6
Sequence MRTELCDRFGIDYPIFVFTPSEKVAAAVSKAGGLGVLGCVRFNDAEDLEN
VLCWMDENTDGKPYGVDIVMPAKVPQEGSAVDIDKLIPQSHRDFVAKTLA
DLGVPPLPDEGERNEGVLGWLHSVARSHVEVALKHPIKLIANALGSPPKD
VIDQAHEAGVPVAALAGSAKHAQRHVENGVDIVVAQGHEAGGHTGEIGSM
VLWPEIVDALDGKAPVLAAGGIGTGRQVAAALALGAQGVWMGSAFLTSAE
YDLGHRKPGGVSTIQEALLRANSSDTVRRRIYTGKPARLLKTRWTDAWDE
PDAPEPLPMPLQNILVSEAHQRMNDSDNPDTVAMPVGQIVGRMNEIRPVA
DIIAELVQGFEDATRRLDGIRES
gene ID433650324
StrainM_smegmatis_JS623
Protein IDYP_007295326.1
Description 2-nitropropane dioxygenase-like enzyme [Mycobacterium smegmatis JS6
Sequence MRTELCDRFGIDYPIFVFTPSEKVAAAVSKAGGLGVLGCVRFNDAEDLEN
VLCWMDENTDGKPYGVDIVMPAKVPQEGSAVDIDKLIPQSHRDFVAKTLA
DLGVPPLPDEGERNEGVLGWLHSVARSHVEVALKHPIKLIANALGSPPKD
VIDQAHEAGVPVAALAGSAKHAQRHVENGVDIVVAQGHEAGGHTGEIGSM
VLWPEIVDALDGKAPVLAAGGIGTGRQVAAALALGAQGVWMGSAFLTSAE
YDLGHRKPGGVSTIQEALLRANSSDTVRRRIYTGKPARLLKTRWTDAWDE
PDAPEPLPMPLQNILVSEAHQRMNDSDNPDTVAMPVGQIVGRMNEIRPVA
DIIAELVQGFEDATRRLDGIRES
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo