Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650410
StrainM_smegmatis_JS623
Protein IDYP_007295412.1
Description hypothetical protein Mycsm_05836 [Mycobacterium smegmatis JS623]
Sequence MLMRTAVAAVAALAAGMLLAGPANADPNDSPCELAISYFCKFIPVAPDLD
HDIDVTQLQPVDPNVPPPDSLPVADPCAAGCI
gene ID433650410
StrainM_smegmatis_JS623
Protein IDYP_007295412.1
Description hypothetical protein Mycsm_05836 [Mycobacterium smegmatis JS623]
Sequence MLMRTAVAAVAALAAGMLLAGPANADPNDSPCELAISYFCKFIPVAPDLD
HDIDVTQLQPVDPNVPPPDSLPVADPCAAGCI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo