Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650412
StrainM_smegmatis_JS623
Protein IDYP_007295414.1
Description lactoylglutathione lyase-like lyase [Mycobacterium smegmatis JS623]
Sequence MSIRSLGYLRIESTDVAAWREYGLKVLGMVEGKGQTEGALYLRMDEFPAR
LVIIPGESDRLLESGWECANAEGLQEIRNRLDLEGTPYKEATAAELADRR
VDEMIRFQDPSGNSLEVFHGAALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDMESLHFYRDVLGFRLRDSMRLPPQLVGRPADGPPAWLRFFGINPRHH
SLAFMPGETPSGIVHLMVEVENADDVGLCLDRALRRKVPMSATLGRHVND
KMLSFYMKTPGGFDVEFGCEGLEVEDTDWVARESTAVSLWGHDFSVGFKS
gene ID433650412
StrainM_smegmatis_JS623
Protein IDYP_007295414.1
Description lactoylglutathione lyase-like lyase [Mycobacterium smegmatis JS623]
Sequence MSIRSLGYLRIESTDVAAWREYGLKVLGMVEGKGQTEGALYLRMDEFPAR
LVIIPGESDRLLESGWECANAEGLQEIRNRLDLEGTPYKEATAAELADRR
VDEMIRFQDPSGNSLEVFHGAALEHRRVVSPYGHKFVTEEQGLGHVVLTT
RDDMESLHFYRDVLGFRLRDSMRLPPQLVGRPADGPPAWLRFFGINPRHH
SLAFMPGETPSGIVHLMVEVENADDVGLCLDRALRRKVPMSATLGRHVND
KMLSFYMKTPGGFDVEFGCEGLEVEDTDWVARESTAVSLWGHDFSVGFKS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo