Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650427
StrainM_smegmatis_JS623
Protein IDYP_007295429.1
Description cob(II)yrinic acid a-c-diamide reductase [Mycobacterium smegmatis J
Sequence MLSRVSEHAFSATERTAVYRAIAERRDMRRFVPGAEVPEDVLARLLQAAH
AAPSVGLMQPWRFIRITDADLRGRIHALVDEERMRTAEALGRRGDQFLTL
KVEGILECAELFVVALADGRQDHVFGRRTLPQMDLASVSCAIQNLWLAAR
AEGLGLGWVSIFDPVRLGALLAMPDGAEPVAILCLGPVPNFPPRPQLEID
HWTFGRPLSEFVSENGWTAPAPA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo