Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650453
StrainM_smegmatis_JS623
Protein IDYP_007295455.1
Description putative thioesterase involved in non-ribosomal peptide biosynthesi
Sequence MAGSRPKLYIFPHAGGSAQYYVPFANAFSKDVQRTAVQYPGQRGSHDVAS
LTSIENLASQVCQMLSAAHRSDDTVAFFGHSMGALLAFEVARRFEAAGTP
ISALFVSACAAPGRSGYEYIPESDRGLLDVVNEMTGANREFLENEEFAAK
ILPTLRGFRAIVNYQCPPESRLSCPIFAYLGDNDVVATYDKVVLWADRTT
AEFSARVFTGHHFYLEDHVSELVADIEAKVMSRRADR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo