Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650483
StrainM_smegmatis_JS623
Protein IDYP_007295485.1
Description Lsr2 [Mycobacterium smegmatis JS623]
Sequence MAKKVTVTLVDDFDGEGAADETVEFGLDGVSYEIDLSSKNAAKLRNDLKQ
WVDAGRRVGGRRRGRSAASGRGRAAIDREQSAAIREWARRNGHNVSTRGR
IPADVIDAFHAAT
B cell epitope (IEDB)6
T cell epitope (IEDB)36
MHC binder (IEDB)0
Vaccine TargetNo