Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650495
StrainM_smegmatis_JS623
Protein IDYP_007295497.1
Description membrane protease FtsH catalytic subunit [Mycobacterium smegmatis J
Sequence MNRKNVIRTLTVIAVILLLGYLFYYFSNDTHDFKRVDTSVAMAQINSDNV
KNAQIDDREQQLRLELKNGNGDTDNNNKVITQFPTGYGVDLFNALTAKNV
QTNTVVTQSSFFTQLLIYLLPLLLLVGLFVMFSRMQTGGRMGFGFGKSRA
KQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNAPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRQ
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDIAGRRAVLRVHSQGKP
IAPDADLDGLAKRTVGMSGADLANVINEAALLTARENGTVITGAALEEAV
DRVVGGPRRKGRIISELEKKITAYHEGGHTLAAWAMPDIEPIYKVTILAR
GRTGGHAVAVPEDDKGLMTRSEMIARLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARAMVTEYGMSSKLGAVRYGTEHGDPFLGRTMGTQADYSHEV
AQAIDDEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRAELEA
IFGDVKKRPRLTMFDDFGGRVPSDKPPIKTPGELAIERGEPWPKPVPEPA
FKAAIAQASQEAAARQAHQNGTNGNGANGIPASAPTQPDYGAPVGWHAPG
WPPQGQPQGQQHHPQHQGYWYPPPHWQQPYPYQPYPQPVQDAPPSPVQDA
PPTPGPNEDPGQDTGRPNG
B cell epitope (IEDB)0
T cell epitope (IEDB)3
MHC binder (IEDB)1
Vaccine TargetNo