Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650511
StrainM_smegmatis_JS623
Protein IDYP_007295513.1
Description penicillin-binding protein- beta-lactamase class C [Mycobacterium s
Sequence MNDVVHGHCDSRFSPVAEALADEIAKGEELGASVAVDIDGELVVDIWGGH
ADRAKTVPWGQDTIVNFFSCTKTLTALAALIAIDRGVIDAFAPVAKYWPE
FAENGKQDIEVRHLMSHTSGVSGWQVPFAIEDIYDWKKATAHLARQEPWW
TPGTASGYHAVNYGHLIGEVIRRATGKTLKEFVRDEIATPLEADVQIGVD
AADEHRVAEIIPPPPLPIALDALPTDHPAYKTFAGFPPDDNTALIVETTG
WRRADIGGVNGHGNARALARALSPISLGGKANGVQMLSPETIDLIFQQQS
YGPDLVLFVPLRFGIGFGLPSPESVPAIPEGRICWWGGWGGSAIVMNPDH
RATFAYVMNKMGPGTTGTARTNRYASLIYQALG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo