Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650513
StrainM_smegmatis_JS623
Protein IDYP_007295515.1
Description integral membrane protein- TerC family [Mycobacterium smegmatis JS6
Sequence MQVTQLEWIITLSVTIAVLLFDVIVIGRRPHEPSKRETGTALAAYVGLAV
AFGVWVWLFHGGQYGLEFFAGWLTEYSLSVDNLFIFLIIMASFKVPKKYQ
QQALLVGIILALVFRGIFIALGAVAINQFSWVFYIFGAFLVYTAINLARD
TEHDDDAENFVVRFARSHLKLTDRWEGLALWVKENGKRLMTPMFLVIIAL
GTTDLLFALDSIPAIYGLTEESYLVFTANVFALMGLRQLYFLLGDLLKRL
VYLSQGLAFILAFIGVKLLLHALHENELPFINGGEHVPVPEIPTLVSLGV
IVVTLVITTAASLYKTRVHDVKKDAQEKALDSA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo