Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650529
StrainM_smegmatis_JS623
Protein IDYP_007295531.1
Description cold shock protein [Mycobacterium smegmatis JS623]
Sequence MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo