Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650541
StrainM_smegmatis_JS623
Protein IDYP_007295543.1
Description acetyl-coenzyme A synthetase [Mycobacterium smegmatis JS623]
Sequence MPTSMQRSVTTLTDMSDAHTEVQSAHPPSPEFTAQANATDELYRAAEADR
LAFWAEQANRLSWDTPFEEVLDWSDAPFAKWFVGGKLNVAYNCVDRHVEA
GNGDRVAIKWEGEPGDSRELTYANLLAEVSKTANALIELGLVAGDRVAIY
MPMLPEAIVAMLACARLGVLHSVVFAGFSSTALAARIEDAEAKLVITSDG
QYRRGQAVSLKESVDEALEAVETAGKSPVEHVLVVRRTGIDTPWTEGRDL
WWHDTVDTASDKHTPEAFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQS
SYTHYNVFDIKPETDVYWCTADIGWVTGHTYIVYGPLSNGCTQVVYEGTP
NSPNEHRHFEVIERYGVTIYYTAPTLIRMFMKWGREIPDAHDLSSLRLLG
SVGEPINPEAWRWYRDAFGGNRTPVVDTWWQTETGAIMISPLPGVTAAKP
GSAMQPLPGISAKIVDEEGSELVPGADEAEHVTGYLVLDQPWPSMLRGIW
GDPERYKETYWSRYADKGWYFAGDGARVDSDGSIWLLGRIDDVMNVSGHR
ISTTEVESALVGHSGVAEAAVVGASDETTGQGICAFVILESHAKDNDNMV
EELRNQVAKEIGKIARPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGD
TSTLVDPSVFEAISASK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo