Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650582
StrainM_smegmatis_JS623
Protein IDYP_007295584.1
Description Kef-type K+ transport system- membrane component [Mycobacterium sme
Sequence MPGFGFDTLALLAVIGMAGPLLASLPRFHVPVIIGELGAGLVVGRTGFGI
VDHTDPTFTLLANIGFALVMFVVGTHVPVRDKTLRSSIPKALLRAVVVGA
VAAVLSVVLAEAFGTGHAAVYAVLMASSSAALALPVIDSLRLDGPPVLSV
TTQIAIADAASIVLLPLVINPGQAWRAALGALTIAGCAAVLYYVLRVATR
RGWRRRLHRYSRKHRLALELRLSLIILFALCALAVTTHVSIMLAGFALGL
VVSAIGEPRRLARQLFGITEGFFGPLFFVWLGASLQVRELGEHPWLILLG
FGLGAGALLAHGVGRLFGQPLTLAVLSAAQLGVPVAAATLGTEQHLLAAG
EPSALMLGALVTVASTSIAGVLAARRQSASTAPSG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo