Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650932
StrainM_smegmatis_JS623
Protein IDYP_007295934.1
Description anti-sigma regulatory factor (Ser/Thr protein kinase) [Mycobacteriu
Sequence MSTSETLCNRSQFARMDAVADPQNAAIIRREFSDWLSEHFPLDAAKACDI
VLAVNEAMANAAEYAYAAADGPGVMAVQATYDDCTATLAVTVTDHGAWRE
TDAGAKQLRRGRGIPLMQALADRATVDSSSTGTRVRLEWNQVGAPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo