Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650962
StrainM_smegmatis_JS623
Protein IDYP_007295964.1
Description cellobiohydrolase A (1-4-beta-cellobiosidase A) [Mycobacterium smeg
Sequence MSAAGAVARWIAPLLTVVAIAGLAVAADPTPAPAVRLAADEGNPLAGASF
YVNPTSTAMRAAQKADPPSPELTAIANTPQAYWLVQGSSAATVAKYVGDA
QAAGAMPVFALYGIPHRDCGSFAAGGFATAADYKGWIDGIAADIGGSPAA
IVVEPDALAMADCLSADQRQERYDLIRYAVETLTRNPAAAVYIDAGHLRW
HSADEMAARLNQAGIAQARGFSLNTANFFTTEDEIGYGEAISGLTNGSHY
VVDTSRNGAGPAPDSPLDWCNPSGRALGTPPTTATAGAHADAYLWIKRPG
ESDGSCNRGDPPAGNFVTEFAVNLARNAGH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo