Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433650986
StrainM_smegmatis_JS623
Protein IDYP_007295988.1
Description uncharacterized membrane-anchored protein [Mycobacterium smegmatis
Sequence MSADSQVLTRREPIAAKVPDITAAFWVLKLTTTAMGEAASDYLLNTVGFV
GFVIGLAGLAFALLVQFRTRLYNVFAYWAAVMMVAVFGTMAADVVHHHLG
VSFGMSTLFCALAVAATFWAWHRSENTLSIHSITTRRREVFYWLTVSFTF
ALGTAAGDLTASQLHFGLVGSIVLFAVIMAVPALGCWRFRLNSVVAFWCA
YIVTRPLGASVADWVSKPTKVGGLDYGDGPVAAVLLVIALILVAVAAVRR
TNKTSPAPPIVTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo