Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440579672
StrainMtb_7199-99
Protein IDCCG10075.1
Description putative ENOYL-CoA HYDRATASE ECHA1 (ENOYL HYDRASE) (UNSATURATED ACYL-Co
Sequence MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLADAMDQ
LDGDAGLSVAILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTK
PLIAAVEGYALAGGTELALAADLIVAARDSAFGIPEVKRGLVAGGGGLLR
LPERIPYAIAMELALTGDNLPAERAHELGLVNVLAEPGTALDAAIALAEK
ITANGPLAVVATKRIITESRGWSPDTMFAEQMKILVPVFTSNDAKEGAIA
FAERRRPRWTGT
B cell epitope (IEDB)0
T cell epitope (IEDB)3
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)30
MHC class II prediction (Propred)33
MHC class 1 prediction (Propred1)172
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)107
Prediction of IL4 inducing peptides (IL4pred)139