Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 440581825 |
| Strain | Mtb_7199-99 |
| Protein ID | CCG12228.1 |
| Description | ESAT-6 LIKE protein ESXP (ESAT-6 LIKE protein 7) [Mycobacterium tubercu |
| Sequence | MATRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAE ATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 17 |
| MHC binder (IEDB) | 315 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 3 |
| MHC class II prediction (Propred) | 9 |
| MHC class 1 prediction (Propred1) | 59 |
| CTL epitope prediction (CTLpred) | 8 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
| Prediction of IL4 inducing peptides (IL4pred) | 66 |