Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 440582135 |
| Strain | Mtb_7199-99 |
| Protein ID | CCG12538.1 |
| Description | putative PROPHAGE protein [Mycobacterium tuberculosis 7199-99] |
| Sequence | MADAVKYVVMCNCDDEPGALIIAWIDDERPAGGHIQMRSNTRFTETQWGR HIEWKLECRACRKYAPISEMTAAAILDGFGAKLHELRTSTIPDADDPSIA EARHVIPFSALCLRLSQLGG |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 1 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 7 |
| MHC class II prediction (Propred) | 14 |
| MHC class 1 prediction (Propred1) | 72 |
| CTL epitope prediction (CTLpred) | 17 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 53 |
| Prediction of IL4 inducing peptides (IL4pred) | 84 |