Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440582426
StrainMtb_7199-99
Protein IDCCG12829.1
Description putative POLYKETIDE SYNTHASE PKS1 [Mycobacterium tuberculosis 7199-99]
Sequence MISARSAEALTAQAGRLMAHVQANPGLDPIDVGCSLASRSVFEHRAVVVG
ASREQLIAGLAGLAAGEPGAGVAVGQPGSVGKTVVVFPGQGAQRIGMGRE
LYGELPVFAQAFDAVADELDRHLRLPLRDVIWGADADLLDSTEFAQPALF
AVEVASFAVLRDWGVLPDFVMGHSVGELAAAHAAGVLTLADAAMLVVARG
RLMQALPAGGAMVAVAASEDEVEPLLGEGVGIAAINAPESVVISGAQAAA
NAIADRFAAQGRRVHQLAVSHAFHSPLMEPMLEEFARVAARVQAREPQLG
LVSNVTGELAGPDFGSAQYWVDHVRRPVRFADSARHLQTLGATHFIEAGP
GSGLTGSIEQSLAPAEAMVVSMLGKDRPELASALGAAGQVFTTGVPVQWS
AVFAGSGGRRVQLPTYAFQRRRFWETPGADGPADAAGLGLGATEHALLGA
VVERPDSDEVVLTGRLSLADQPWLADHVVNGVVLFPGAGFVELVIRAGDE
VGCALIEELVLAAPLVMHPGVGVQVQVVVGAADESGHRAVSVYSRGDQSQ
GWLLNAEGMLGVAAAETPMDLSVWPPEGAESVDISDGYAQLAERGYAYGP
AFQGLVAIWRRGSELFAEVVAPGEAGVAVDRMGMHPAVLDAVLHALGLAV
EKTQASTETRLPFCWRGVSLHAGGAGRVRARFASAGADAISVDVCDATGL
PVLTVRSLVTRPITAEQLRAAVTAAGGASDQGPLEVVWSPISVVSGGANG
SAPPAPVSWADFCAGSDGDASVVVWELESAGGQASSVVGSVYAATHTALE
VLQSWLGADRAATLVVLTHGGVGLAGEDISDLAAAAVWGMARSAQAENPG
RIVLIDTDAAVDASVLAGVGEPQLLVRGGTVHAPRLSPAPALLALPAAES
AWRLAAGGGGTLEDLVIQPCPEVQAPLQAGQVRVAVAAVGVNFRDVVAAL
GMYPGQAPPLGAEGAGVVLETGPEVTDLAVGDAVMGFLGGAGPLAVVDQQ
LVTRVPQGWSFAQAAAVPVVFLTAWYGLADLAEIKAGESVLIHAGTGGVG
MAAVQLARQWGVEVFVTASRGKWDTLRAMGFDDDHIGDSRTCEFEEKFLA
VTEGRGVDVVLDSLAGEFVDASLRLLVRGGRFLEMGKTDIRDAQEIAANY
PGVQYRAFDLSEAGPARMQEMLAEVRELFDTRELHRLPVTTWDVRCAPAA
FRFMSQARHIGKVVLTMPSALADRLADGTVVITGATGAVGGVLARHLVGA
YGVRHLVLASRRGDRAEGAAELAADLTEAGAKVQVVACDVADRAAVAGLF
AQLSREYPPVRGVIHAAGVLDDAVITSLTPDRIDTVLRAKVDAAWNLHQA
TSDLDLSMFALCSSIAATVGSPGQGNYSAANAFLDGLAAHRQAAGLAGIS
LAWGLWEQPGGMTAHLSSRDLARMSRSGLAPMSPAEAVELFDAALAIDHP
LAVATLLDRAALDARAQAGALPALFSGLARRPRRRQIDDTGDATSSKSAL
AQRLHGLAADEQLELLVGLVCLQAAAVLGRPSAEDVDPDTEFGDLGFDSL
TAVELRNRLKTATGLTLPPTVIFDHPTPTAVAEYVAQQMSGSRPTESGDP
TSQVVEPAAAEVSVHA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)143
MHC class II prediction (Propred)206
MHC class 1 prediction (Propred1)1099
CTL epitope prediction (CTLpred)227
Prediction of interferon-gamma inducing peptides (IFNepitope)707
Prediction of IL4 inducing peptides (IL4pred)966