Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440582427
StrainMtb_7199-99
Protein IDCCG12830.1
Description putative POLYKETIDE SYNTHASE PKS15 [Mycobacterium tuberculosis 7199-99]
Sequence MIEEQRTMSVEGADQQSEKLFHYLKKVAVELDETRARLREYEQRATEPVA
VVGIGCRFPGGVDGPDGLWDVVSAGRDVVSEFPTDRGWDVEGLYDPDPDA
EGKTYTRWGAFLDDATGFDAGFFGIAPSEVLAMDPQQRLMLEVSWEALEH
AGIDPLSLRGSATGVYTGIFAASYGNRDTGGLQGYGLTGTSISVASGRVS
YVLGLQGPAVSVDTACSSSLVAIHWAMSSLRSGECDLALAGGVTVMGLPS
IFVGFSRQRGLAADGRCKAFAAAADGTGWGEGAGVVVLERLSDARRLGHS
VLAVVRGSAVNQDGASNGLTAPNGLAQQRVIQAALANAGLSAADVDVVEA
HGTATTLGDPIEAQALLSTYGQGGPAEQPLWVGSIKSNMGHTQAAAGVAG
VIKMVQAMRHGVMPATLHVDEPSPRVDWTSGAVSVLTEAREWSVDGRPRR
AAVSSFGISGTNAHLILEEAPVPAPAEAPVEASESTGGRGRRWCRG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)45
MHC class II prediction (Propred)61
MHC class 1 prediction (Propred1)320
CTL epitope prediction (CTLpred)66
Prediction of interferon-gamma inducing peptides (IFNepitope)256
Prediction of IL4 inducing peptides (IL4pred)338