Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440583123
StrainMtb_7199-99
Protein IDCCG13526.1
Description ESX-1 SECRETION-ASSOCIATED protein ESPC [Mycobacterium tuberculosis 719
Sequence MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQ
FNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDG
LFT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)15
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)139
CTL epitope prediction (CTLpred)20
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)107