Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440583381
StrainMtb_7199-99
Protein IDCCG13784.1
Description ESX-1 SECRETION-ASSOCIATED protein ESPH [Mycobacterium tuberculosis 719
Sequence MVDPPGNDDDHGDLDALDFSAAHTNEASPLDALDDYAPVQTDDAEGDLDA
LHALTERDEEPELELFTVTNPQGSVSVSTLMDGRIQHVELTDKATSMSEA
QLADEIFVIADLARQKARASQYTFMVENIGELTDEDAEGSALLREFVGMT
LNLPTPEEAAAAEAEVFATRYDVDYTSRYKADD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)32
MHC class II prediction (Propred)31
MHC class 1 prediction (Propred1)233
CTL epitope prediction (CTLpred)36
Prediction of interferon-gamma inducing peptides (IFNepitope)158
Prediction of IL4 inducing peptides (IL4pred)210