Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID440583388
StrainMtb_7199-99
Protein IDCCG13791.1
Description 10 KDA CULTURE FILTRATE ANTIGEN ESXB (LHP) (CFP10) [Mycobacterium tuber
Sequence MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTA
AQAAVVRFQEAANKQKQKLDEISTNIRQAGVQYSRADEEQQQALSSQMGF
B cell epitope (IEDB)23
T cell epitope (IEDB)240
MHC binder (IEDB)329
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)27
MHC class 1 prediction (Propred1)169
CTL epitope prediction (CTLpred)24
Prediction of interferon-gamma inducing peptides (IFNepitope)90
Prediction of IL4 inducing peptides (IL4pred)202