Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441213707
StrainM_smegmatis_MKD8
Protein IDZP_20975953.1
Description short-chain dehydrogenase/reductase family [Mycobacterium smegmatis
Sequence MEGFAGKVAVVTGAGSGIGQALAIELGRSGAKLAICDVDTEGLAATEERL
KAIGAPVKADRLDVTEREAFLLYADAVKEHYGTVNQIYNNAGIAFTGDVE
ISEFKDIERVMDVDFWGVVNGTKAFLPHLIASGDGHVINVSSVFGLFSVP
GQAAYNSAKFAVRGFTEALRQEMAIAKHPVKVTTVHPGGIKTAIARNATA
AEGLDAKELAEAFDKKLANTTPQRAAVIILDGVRKNKARVLVGPDAKILD
VIVRITGSGYQRLFSAVAAKAMPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo