Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441213999
StrainM_smegmatis_MKD8
Protein IDZP_20976026.1
Description hypothetical protein D806_5198 [Mycobacterium smegmatis MKD8]
Sequence MKPSKIAALKPKKKCCRSKPRCKRCPVVLHKVRKAELNGLRGKDLEKVYK
RSRKS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo