Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214234
StrainM_smegmatis_MKD8
Protein IDZP_20976058.1
Description zinc-binding alcohol dehydrogenase family protein [Mycobacterium sme
Sequence MPTMTAIGSFAALPVDDPDSLQDITIEVPELRPHDVLVRVEAVSVNPVDI
KRRRSLSPSAEPTILGFDAAGVVEAVGSEVTTLSVGDEVWYAGDVSRPGT
NAQLHAVDERIVARKPRSLSFRDAAALPLTTITAWETLFERFNLTADSRG
DLLVLGAAGGVGSVMIQLAKKLTGVRVIATASRDESRQWARDLGADEVID
HHDLRAQALDVAPDGVDYLFTPFSAGNVDVFADIVRPFGHITAIDEPEGL
DLVGLKTKSIAWHWELMFTRPLTGYDIAAQQRLLADAADLVDRGELRTTL
TTAIDGFTAANLREAHRMVESGRMVGKVVVSR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo