Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214286
StrainM_smegmatis_MKD8
Protein IDZP_20976110.1
Description RNA polymerase sigma factor [Mycobacterium smegmatis MKD8]
Sequence MLAVEQPTERMLELYANHVDPLRRYAFRLTSNQTRSEDIVQETFLRAWRH
LQNNDGDLPLRSWLFTVARNIVIDGSRSARVRYEVSSPDTPEVPDRMGAD
EVNAALDRILVAEAMAQLPESHRAVLSRSFYLGWTTGRIAEDLGIAEGTV
KSRLHYSLKRLRLILAEMGCHARS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo