Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214417
StrainM_smegmatis_MKD8
Protein IDZP_20976127.1
Description hypothetical protein D806_5296 [Mycobacterium smegmatis MKD8]
Sequence MDTRVIVYPGTDNELHGVVVEDFADLAGTAVEIAGERIVGPARRYAVNVD
DGGLVFVDDDSIVAEAQPA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo