Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214431
StrainM_smegmatis_MKD8
Protein IDZP_20976141.1
Description putative NAD(P)H nitroreductase acg [Mycobacterium smegmatis MKD8]
Sequence MSDTRLDVATLANAVQLAARAPSLHNTQPWRLIAEDGELKLFLDPSRVVR
STDRSSREAVMSCGVLLDHLRVALAAAGWDTEVQRFPNPNDRDHLATLSF
RPLQFVTEGHRKRADAILARRTDRLPMSAYVDWDAFETLLRARLGDGPVH
MDTLGEDVREEVAEAAALTESLRLYDAAYHSELAWWTTPFATEDGIPQTA
LISAEESERVAVSRDFPVAPHSSRRSALNNDAATIVVLSTDGYSREDALD
AGEGLSKVLLECTMSGLATCPVTHVTELHTSRDIIGRLIVRDACPQVLVR
IGLAPALDEVPPPTPRRPVDAFLEVRPRS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo