Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214650
StrainM_smegmatis_MKD8
Protein IDZP_20976206.1
Description putative ABC transport system- ATP-binding protein [Mycobacterium sm
Sequence MIEITRLVKRFGATVAVDDVTASFPAGTVTGLLGLNGAGKTTLLRLIAGL
DHPDSGDVTLCGRPIRDHADPMRTLGVHFDPDAMDPRHTAERHLRWLAAL
GGIDGGRVDAVLAEVGLDELRHRRIANLSMGARQRLAIASALLGDPQVLV
FDEPVNGLDVPGIVWLRELLHRLAGRGCTVVVASHLLGEVVLTADRLLVL
QRGKVKVAGALADVTPAGADPRDHLESLLLETVDA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo