Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214740
StrainM_smegmatis_MKD8
Protein IDZP_20976296.1
Description transcriptional regulator- ArsR family protein [Mycobacterium smegma
Sequence MGHGVEGRSTPAASLDAASAVKVAETLQALASPNRLLILTRLRESPCSVT
ELSAAVGMEQPAVSNQLRLLRTLGLVTGDRSGRNIVYRLYDSHVAQLLDE
AIYHIEHLRLGVRDGTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo