Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID441214743
StrainM_smegmatis_MKD8
Protein IDZP_20976299.1
Description prolipoprotein diacylglyceryl transferase [Mycobacterium smegmatis M
Sequence MTVEVHGLFVALAVFAAVLVFSHEARRRGAVNEQSIVAVAGALIGGAIGM
RLSGWAQHLDLSANPSLAQAWEFGSRSILGGLLGAYIGVHVAKRLGGYRG
KTGDLFAPAVALGMAIGRIGCLLTEAPGRPTNLPWGIHAPASTPECPACL
TGQAMHPSFVYEIVFQLVAFAVLLWLRNRITHPGELFVIYIAAYAVFRFF
VEFFRANETVWLDLTRPQWFLLPTLLIIGFRLCYGYRHGYYRRAARSEEV
PV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo